vodafone guthaben lässt sich nicht aufladen

, 30. Dezember 2020

"event" : "kudoEntity", "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", "event" : "deleteMessage", "actions" : [ "actions" : [ "context" : "envParam:entity", } { "actions" : [ } { "action" : "rerender" ] "actions" : [ "action" : "rerender" }, }, { { "actions" : [ { ', 'ajax'); "event" : "MessagesWidgetEditCommentForm", }, "actions" : [ "event" : "MessagesWidgetEditAction", "context" : "", "initiatorDataMatcher" : "data-lia-message-uid" document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); "quiltName" : "ForumMessage", "componentId" : "kudos.widget.button", } "selector" : "#messageview_3", "messageViewOptions" : "1111110111111111111110111110100101001101" ] "displaySubject" : "true", resetMenu(); { LITHIUM.AjaxSupport.fromLink('#kudoEntity_9', 'kudoEntity', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {}, 'jldz6ssot1CquMqP9U6Ux5v6W6_Rv9zP96CUFOzJofQ. }); { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Archiv_CallYa/thread-id/59151","ajaxErrorEventName":"LITHIUM:ajaxError","token":"DuDawUpDNyEjGe6kvOOGZYJbFuKxxAHzDO5O46jiZL8. "disallowZeroCount" : "false", "kudosLinksDisabled" : "false", "event" : "MessagesWidgetEditAnswerForm", LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); "quiltName" : "ForumMessage", }, }, "event" : "MessagesWidgetEditCommentForm", { LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1444565}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1444867}},{"elementId":"link_19","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1444573}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1444596}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1444648}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1444650}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1444656}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1444659}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1444692}},{"elementId":"link_47","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1444728}},{"elementId":"link_51","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1444826}}]); LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ] "actions" : [ { "context" : "envParam:entity", } { "actions" : [ "truncateBody" : "true", ] "actions" : [ "actions" : [ { "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, }, { "includeRepliesModerationState" : "false", { "event" : "markAsSpamWithoutRedirect", } ] }, "actions" : [ "actions" : [ "actions" : [ ] { { { "actions" : [ } } ] if ( !watching ) { "event" : "deleteMessage", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1444692 .lia-rating-control-passive', '#form_7'); "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'z8w0FZgJnuZtk-XX44_pS_K0NsN1AWCICX1Hm7asy74. } } "action" : "rerender" "displaySubject" : "true", "context" : "", } ] "actions" : [ }, "actions" : [ ] .attr('aria-expanded','false'); "context" : "", }, "event" : "addThreadUserEmailSubscription", { } } { { "parameters" : { "includeRepliesModerationState" : "false", ] }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } else { "action" : "rerender" "event" : "unapproveMessage", { "componentId" : "forums.widget.message-view", { } }, "action" : "rerender" "context" : "envParam:feedbackData", ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } "componentId" : "kudos.widget.button", "action" : "rerender" }, LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); "event" : "RevokeSolutionAction", "actions" : [ "event" : "deleteMessage", "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ ] { "context" : "envParam:quiltName", { "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", { { ] "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); { "eventActions" : [ "event" : "MessagesWidgetEditAction", "action" : "rerender" ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] }); watching = false; { { "actions" : [ { } ] "useCountToKudo" : "false", ] "actions" : [ { ] }, { } { "kudosLinksDisabled" : "false", "context" : "", { "actions" : [ } ] "action" : "rerender" { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1677183 .lia-rating-control-passive', '#form_1'); { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1679305 .lia-rating-control-passive', '#form_3'); "event" : "QuickReply", "actions" : [ "displaySubject" : "true", ] "context" : "", "}); } "initiatorBinding" : true, "action" : "rerender" "initiatorBinding" : true, { "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'aI1D1XLSwNg0iqVyFsqcGGOBSJzBpA08j3AOd6OZ-OQ. if ( !watching ) { { }, "selector" : "#kudosButtonV2_9", { "action" : "rerender" })(LITHIUM.jQuery); "entity" : "1444596", "eventActions" : [ "displaySubject" : "true", { { } } "context" : "envParam:quiltName", } LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); "actions" : [ ] "event" : "AcceptSolutionAction", }, "context" : "envParam:feedbackData", { return false; LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1444648,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "}); }, }, LITHIUM.AjaxSupport.ComponentEvents.set({ } }, { }, // Reset the conditions so that someone can do it all again. { "action" : "addClassName" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "markAsSpamWithoutRedirect", ] { { "quiltName" : "ForumMessage", }, "actions" : [ } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_10","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "displaySubject" : "true", // If watching, pay attention to key presses, looking for right sequence. "context" : "", "event" : "MessagesWidgetCommentForm", "action" : "rerender" "event" : "editProductMessage", "event" : "AcceptSolutionAction", ] }, "forceSearchRequestParameterForBlurbBuilder" : "false", "componentId" : "forums.widget.message-view", "buttonDialogCloseAlt" : "Schließen", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1676536 .lia-rating-control-passive', '#form'); "useSimpleView" : "false", "displaySubject" : "true", "event" : "MessagesWidgetEditCommentForm", ] "action" : "pulsate" "event" : "approveMessage", "action" : "rerender" "action" : "rerender" "event" : "expandMessage", { } }, "event" : "approveMessage", if (isNaN(val) ) { { { { } "}); }, { "actions" : [ ] "linkDisabled" : "false" }); clearWarning(pagerId); "action" : "rerender" "event" : "approveMessage", } } "action" : "rerender" "useCountToKudo" : "false", "action" : "rerender" }, "action" : "addClassName" "useSubjectIcons" : "true", { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); }, LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "", }, LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; { "useSubjectIcons" : "true", "action" : "rerender" "truncateBody" : "true", "context" : "lia-deleted-state", $(this).removeAttr('href'); "context" : "", } "kudosLinksDisabled" : "false", { "context" : "", "actions" : [ { "useSubjectIcons" : "true", "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ "event" : "editProductMessage", "messageViewOptions" : "1111110111111111111110111110100101001101" { { LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 't2wH9Lb6avljJmCqepasngs5n9MDVY3IQYaJ1xZKqpY. }, ] "context" : "", ] ], "action" : "rerender" "disableLabelLinks" : "false", }, "event" : "expandMessage", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101001101" }); { "event" : "QuickReply", "event" : "AcceptSolutionAction", ] ] } { "action" : "rerender" { { $(document).ready(function(){ "parameters" : { ] ] { "event" : "RevokeSolutionAction", LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'aI1D1XLSwNg0iqVyFsqcGGOBSJzBpA08j3AOd6OZ-OQ. watching = false; "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName", { "context" : "", "actions" : [ "kudosable" : "true", "actions" : [ "entity" : "1444565", "context" : "", } { LITHIUM.StarRating('#any_10', false, 1, 'LITHIUM:starRating'); "kudosLinksDisabled" : "false", "actions" : [ { ] var key = e.keyCode; $(this).toggleClass("view-btn-open view-btn-close"); } "event" : "RevokeSolutionAction", { }, "forceSearchRequestParameterForBlurbBuilder" : "false", ] "action" : "rerender" { ","loaderSelector":"#lineardisplaymessageviewwrapper_9 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'isxHJQmnUM_8dZwG7rKF_DVnUq5A-o6j5YS8XRe024w. "actions" : [ "action" : "rerender" } { "event" : "kudoEntity", { { { "actions" : [ "context" : "", "action" : "rerender" } { { "kudosable" : "true", { "event" : "MessagesWidgetAnswerForm", LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'glnadWHtPx7dCkpVZsxPh0PgrepFKp55fog_e50BVjY. }, "event" : "AcceptSolutionAction", "truncateBodyRetainsHtml" : "false", } { ] { "disableLinks" : "false", { }, } "context" : "", } "action" : "rerender" "event" : "unapproveMessage", } if (1 != val) "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { createStorage("true"); { { })(LITHIUM.jQuery); } "kudosLinksDisabled" : "false", "action" : "rerender" }, "context" : "envParam:entity", "}); "kudosable" : "true", "context" : "envParam:quiltName,product,contextId,contextUrl", } else { ] "truncateBodyRetainsHtml" : "false", "action" : "rerender" "context" : "", { } { ] "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101001101" ] "selector" : "#messageview_8", "parameters" : { "actions" : [ "disableLabelLinks" : "false", '; { "action" : "rerender" "action" : "rerender" { } } ] { { "context" : "", }, ;(function($) { ] "parameters" : { { "context" : "", } } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "truncateBodyRetainsHtml" : "false", ] LITHIUM.AjaxSupport.ComponentEvents.set({ }); ] }, } } "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" }); { "context" : "envParam:quiltName,expandedQuiltName", "event" : "MessagesWidgetEditCommentForm", ] ] "disableLinks" : "false", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "pulsate" "context" : "", "action" : "rerender" "action" : "rerender" }, { count = 0; } "context" : "envParam:quiltName,expandedQuiltName", }; "actions" : [ ] { }, ] { } ', 'ajax'); "event" : "MessagesWidgetEditAnswerForm", "event" : "approveMessage", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); "event" : "removeMessageUserEmailSubscription", ] } "useSimpleView" : "false", }); "defaultAriaLabel" : "", "event" : "MessagesWidgetEditAnswerForm", { { "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "envParam:selectedMessage", "event" : "deleteMessage", "context" : "", "context" : "", setWarning(pagerId); "event" : "ProductAnswer", "actions" : [ ] $(document).keydown(function(e) { Bist du sicher, dass du fortfahren möchtest? { }, function clearWarning(pagerId) { } "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'mAnZtkFC_aMwWvnW-rT6eXwL7yTcyk0EQb4b9zwU6Qo. } "useSubjectIcons" : "true", "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName", } }, "event" : "editProductMessage", "initiatorBinding" : true, "eventActions" : [ "action" : "rerender" ] ] "action" : "rerender" "actions" : [ { } }, "componentId" : "kudos.widget.button", "actions" : [ }, "forceSearchRequestParameterForBlurbBuilder" : "false", ] ] "includeRepliesModerationState" : "false", { "kudosable" : "true", return false; // --> "event" : "expandMessage", "componentId" : "kudos.widget.button", } "actions" : [ } // Oops. "actions" : [ "initiatorBinding" : true, }, } "event" : "kudoEntity", "componentId" : "forums.widget.message-view", "buttonDialogCloseAlt" : "Schließen", "context" : "envParam:feedbackData", }, Bist du sicher, dass du fortfahren möchtest? "context" : "", { "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ element.siblings('li').find('li').removeClass('active'); "actions" : [ "context" : "", ] "componentId" : "forums.widget.message-view", }, LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); "includeRepliesModerationState" : "false", { "ajaxEvent" : "LITHIUM:lightboxRenderComponent", } { "actions" : [ { "action" : "rerender" }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:quiltName", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); "context" : "lia-deleted-state", { // just for convenience, you need a login anyways... ;(function($) { } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1444867 .lia-rating-control-passive', '#form_0'); }); ] { "actions" : [ document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); "event" : "editProductMessage", ] "action" : "rerender" "event" : "kudoEntity", } { "action" : "rerender" { { "actions" : [ "context" : "envParam:quiltName", { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { }, }, "context" : "", "action" : "rerender" "event" : "addMessageUserEmailSubscription", { "event" : "MessagesWidgetMessageEdit", "forceSearchRequestParameterForBlurbBuilder" : "false", "selector" : "#kudosButtonV2_1", ] "event" : "MessagesWidgetCommentForm", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1444565 .lia-rating-control-passive', '#form'); { { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { } ] "messageViewOptions" : "1111110111111111111110111110100101001101" function setWarning(pagerId) {

Fortbildung Digitalisierung Schule, Anästhesie Klinik Links Vom Rhein, Evil Eye Wikipedia, Ein Blindes Huhn Findet Auch Mal Ein Korn, Jürgen Kaube Hegel, Red Bull Contact, Wann Habt Ihr 2 Schwangerschaft Bemerkt, Baugebiet Kandel Bad Rappenau, Fuge 4 Buchstaben, Schülerpraktikum Vw Hannover,

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.